Lineage for d2qe7f1 (2qe7 F:2-76)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795900Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 1795901Protein automated matches [254527] (7 species)
    not a true protein
  7. 1795902Species Bacillus sp. [TaxId:90973] [255559] (1 PDB entry)
  8. 1795908Domain d2qe7f1: 2qe7 F:2-76 [243551]
    Other proteins in same PDB: d2qe7a2, d2qe7a3, d2qe7b2, d2qe7b3, d2qe7c2, d2qe7c3, d2qe7d2, d2qe7d3, d2qe7e2, d2qe7e3, d2qe7f2, d2qe7f3, d2qe7g_
    automated match to d1skye2

Details for d2qe7f1

PDB Entry: 2qe7 (more details), 3.06 Å

PDB Description: Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d2qe7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qe7f1 b.49.1.0 (F:2-76) automated matches {Bacillus sp. [TaxId: 90973]}
nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
dglvrgleavdtgap

SCOPe Domain Coordinates for d2qe7f1:

Click to download the PDB-style file with coordinates for d2qe7f1.
(The format of our PDB-style files is described here.)

Timeline for d2qe7f1: