SCOPe 2.08: Domain d2qe7e3: 2qe7 E:350-462

Lineage for d2qe7e3 (2qe7 E:350-462)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Bacillus sp. [TaxId:90973] [255561] (1 PDB entry)

8. Domain d2qe7e3: 2qe7 E:350-462 [243550]
   Other proteins in same PDB: d2qe7a1, d2qe7a2, d2qe7b1, d2qe7b2, d2qe7c1, d2qe7c2, d2qe7d1, d2qe7d2, d2qe7e1, d2qe7e2, d2qe7f1, d2qe7f2, d2qe7g_
   automated match to d1skye1

Details for d2qe7e3

PDB Entry: 2qe7, 3.06 Å

PDB Description: Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1

PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d2qe7e3:

Sequence; same for both SEQRES and ATOM records:

>d2qe7e3 a.69.1.0 (E:350-462) automated matches {Bacillus sp. [TaxId: 90973]}
avvgeehyrvargvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhv
aeqftgmpgkyvpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl

Timeline for d2qe7e3:

• d2qe7e3 first appeared in SCOPe 2.04
  
• d2qe7e3 appears in SCOPe 2.07