| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
| Protein automated matches [190393] (12 species) not a true protein |
| Species Bacillus sp. [TaxId:90973] [255562] (1 PDB entry) |
| Domain d2qe7d2: 2qe7 D:77-349 [243546] Other proteins in same PDB: d2qe7a1, d2qe7a2, d2qe7a3, d2qe7b1, d2qe7b2, d2qe7b3, d2qe7c1, d2qe7c2, d2qe7c3, d2qe7d1, d2qe7d3, d2qe7e1, d2qe7e3, d2qe7f1, d2qe7f3, d2qe7g_ automated match to d1skye3 |
PDB Entry: 2qe7 (more details), 3.06 Å
SCOPe Domain Sequences for d2qe7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qe7d2 c.37.1.11 (D:77-349) automated matches {Bacillus sp. [TaxId: 90973]}
isvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeelstadeiletgikvid
llapyakggkiglfggagvgktvliqelinnvaqehgglsvfagvgertregndlyhemk
dsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvllfidnifrftqagse
vsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyvpaddytdpapattfa
hldattnlerklaemgiypavdplastsrilsp
Timeline for d2qe7d2: