Lineage for d2qe7d2 (2qe7 D:77-349)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869998Protein automated matches [190393] (12 species)
    not a true protein
  7. 2869999Species Bacillus sp. [TaxId:90973] [255562] (1 PDB entry)
  8. 2870000Domain d2qe7d2: 2qe7 D:77-349 [243546]
    Other proteins in same PDB: d2qe7a1, d2qe7a2, d2qe7a3, d2qe7b1, d2qe7b2, d2qe7b3, d2qe7c1, d2qe7c2, d2qe7c3, d2qe7d1, d2qe7d3, d2qe7e1, d2qe7e3, d2qe7f1, d2qe7f3, d2qe7g_
    automated match to d1skye3

Details for d2qe7d2

PDB Entry: 2qe7 (more details), 3.06 Å

PDB Description: Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
PDB Compounds: (D:) ATP synthase subunit beta

SCOPe Domain Sequences for d2qe7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qe7d2 c.37.1.11 (D:77-349) automated matches {Bacillus sp. [TaxId: 90973]}
isvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeelstadeiletgikvid
llapyakggkiglfggagvgktvliqelinnvaqehgglsvfagvgertregndlyhemk
dsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvllfidnifrftqagse
vsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyvpaddytdpapattfa
hldattnlerklaemgiypavdplastsrilsp

SCOPe Domain Coordinates for d2qe7d2:

Click to download the PDB-style file with coordinates for d2qe7d2.
(The format of our PDB-style files is described here.)

Timeline for d2qe7d2: