![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
![]() | Protein automated matches [254527] (17 species) not a true protein |
![]() | Species Bacillus sp. [TaxId:90973] [255559] (1 PDB entry) |
![]() | Domain d2qe7d1: 2qe7 D:2-76 [243545] Other proteins in same PDB: d2qe7a2, d2qe7a3, d2qe7b2, d2qe7b3, d2qe7c2, d2qe7c3, d2qe7d2, d2qe7d3, d2qe7e2, d2qe7e3, d2qe7f2, d2qe7f3, d2qe7g_ automated match to d1skye2 |
PDB Entry: 2qe7 (more details), 3.06 Å
SCOPe Domain Sequences for d2qe7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qe7d1 b.49.1.0 (D:2-76) automated matches {Bacillus sp. [TaxId: 90973]} nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast dglvrgleavdtgap
Timeline for d2qe7d1: