SCOPe 2.04: Domain d2qe7c3: 2qe7 C:372-500

Lineage for d2qe7c3 (2qe7 C:372-500)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (6 species)
   not a true protein

7. Species Bacillus sp. [TaxId:90973] [255561] (1 PDB entry)

8. Domain d2qe7c3: 2qe7 C:372-500 [243544]
   Other proteins in same PDB: d2qe7a1, d2qe7a2, d2qe7b1, d2qe7b2, d2qe7c1, d2qe7c2, d2qe7d1, d2qe7d2, d2qe7e1, d2qe7e2, d2qe7f1, d2qe7f2, d2qe7g_
   automated match to d1maba1

Details for d2qe7c3

PDB Entry: 2qe7, 3.06 Å

PDB Description: Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1

PDB Compounds: (C:) ATP synthase subunit alpha

SCOPe Domain Sequences for d2qe7c3:

Sequence; same for both SEQRES and ATOM records:

>d2qe7c3 a.69.1.0 (C:372-500) automated matches {Bacillus sp. [TaxId: 90973]}
ikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpve
eqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaai
eefkkgftp

Timeline for d2qe7c3:

• d2qe7c3 is new in SCOPe 2.04-stable
  
• d2qe7c3 appears in SCOPe 2.05
  
• d2qe7c3 appears in the current release, SCOPe 2.08