Lineage for d2qe7c1 (2qe7 C:27-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798833Species Bacillus sp. [TaxId:90973] [255559] (1 PDB entry)
  8. 2798836Domain d2qe7c1: 2qe7 C:27-94 [243542]
    Other proteins in same PDB: d2qe7a2, d2qe7a3, d2qe7b2, d2qe7b3, d2qe7c2, d2qe7c3, d2qe7d2, d2qe7d3, d2qe7e2, d2qe7e3, d2qe7f2, d2qe7f3, d2qe7g_
    automated match to d1maba2

Details for d2qe7c1

PDB Entry: 2qe7 (more details), 3.06 Å

PDB Description: Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
PDB Compounds: (C:) ATP synthase subunit alpha

SCOPe Domain Sequences for d2qe7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qe7c1 b.49.1.0 (C:27-94) automated matches {Bacillus sp. [TaxId: 90973]}
evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
qvkrtgri

SCOPe Domain Coordinates for d2qe7c1:

Click to download the PDB-style file with coordinates for d2qe7c1.
(The format of our PDB-style files is described here.)

Timeline for d2qe7c1: