Lineage for d2qe7a3 (2qe7 A:372-500)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717540Species Bacillus sp. [TaxId:90973] [255561] (1 PDB entry)
  8. 2717541Domain d2qe7a3: 2qe7 A:372-500 [243538]
    Other proteins in same PDB: d2qe7a1, d2qe7a2, d2qe7b1, d2qe7b2, d2qe7c1, d2qe7c2, d2qe7d1, d2qe7d2, d2qe7e1, d2qe7e2, d2qe7f1, d2qe7f2, d2qe7g_
    automated match to d1maba1

Details for d2qe7a3

PDB Entry: 2qe7 (more details), 3.06 Å

PDB Description: Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
PDB Compounds: (A:) ATP synthase subunit alpha

SCOPe Domain Sequences for d2qe7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qe7a3 a.69.1.0 (A:372-500) automated matches {Bacillus sp. [TaxId: 90973]}
ikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpve
eqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaai
eefkkgftp

SCOPe Domain Coordinates for d2qe7a3:

Click to download the PDB-style file with coordinates for d2qe7a3.
(The format of our PDB-style files is described here.)

Timeline for d2qe7a3: