| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
| Protein automated matches [254528] (17 species) not a true protein |
| Species Bacillus sp. [TaxId:90973] [255561] (1 PDB entry) |
| Domain d2qe7a3: 2qe7 A:372-500 [243538] Other proteins in same PDB: d2qe7a1, d2qe7a2, d2qe7b1, d2qe7b2, d2qe7c1, d2qe7c2, d2qe7d1, d2qe7d2, d2qe7e1, d2qe7e2, d2qe7f1, d2qe7f2, d2qe7g_ automated match to d1maba1 |
PDB Entry: 2qe7 (more details), 3.06 Å
SCOPe Domain Sequences for d2qe7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qe7a3 a.69.1.0 (A:372-500) automated matches {Bacillus sp. [TaxId: 90973]}
ikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpve
eqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaai
eefkkgftp
Timeline for d2qe7a3: