SCOPe 2.06: Domain d2qcxb1: 2qcx B:1-226

Lineage for d2qcxb1 (2qcx B:1-226)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
   Uniprot P25052

8. Domain d2qcxb1: 2qcx B:1-226 [243533]
   Other proteins in same PDB: d2qcxa2, d2qcxb2
   automated match to d1to9a_
   complexed with pf1; mutant

Details for d2qcxb1

PDB Entry: 2qcx, 2.2 Å

PDB Description: crystal structure of bacillus subtilis tena y112f mutant complexed with formyl aminomethyl pyrimidine

PDB Compounds: (B:) Transcriptional activator tenA

SCOPe Domain Sequences for d2qcxb1:

Sequence; same for both SEQRES and ATOM records:

>d2qcxb1 a.132.1.3 (B:1-226) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
mkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysftshmyrsv
lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
elaensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikev

Timeline for d2qcxb1:

• d2qcxb1 first appeared in SCOPe 2.04, called d2qcxb_
  
• d2qcxb1 was called d2qcxb_ in SCOPe 2.05
  
• d2qcxb1 appears in SCOPe 2.07
  
• d2qcxb1 appears in the current release, SCOPe 2.08