SCOPe 2.05: Domain d2qcxb_: 2qcx B:

Lineage for d2qcxb_ (2qcx B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
   Uniprot P25052

8. Domain d2qcxb_: 2qcx B: [243533]
   automated match to d1to9a_
   complexed with pf1; mutant

Details for d2qcxb_

PDB Entry: 2qcx, 2.2 Å

PDB Description: crystal structure of bacillus subtilis tena y112f mutant complexed with formyl aminomethyl pyrimidine

PDB Compounds: (B:) Transcriptional activator tenA

SCOPe Domain Sequences for d2qcxb_:

Sequence; same for both SEQRES and ATOM records:

>d2qcxb_ a.132.1.3 (B:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
gmkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfga
ayakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysftshmyrs
vlsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrf
delaensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikev

Timeline for d2qcxb_:

• d2qcxb_ first appeared in SCOPe 2.04
  
• d2qcxb_ is called d2qcxb1 in SCOPe 2.06
  
• d2qcxb_ appears in the current release, SCOPe 2.08, called d2qcxb1