SCOPe 2.04: Domain d2q8ga1: 2q8g A:41-202

Lineage for d2q8ga1 (2q8g A:41-202)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.0: automated matches [230678] (1 protein)
   not a true family

6. Protein automated matches [230679] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230680] (8 PDB entries)

8. Domain d2q8ga1: 2q8g A:41-202 [243526]
   Other proteins in same PDB: d2q8ga2
   automated match to d2bu8a1
   complexed with azx, k

Details for d2q8ga1

PDB Entry: 2q8g, 1.9 Å

PDB Description: structure of pyruvate dehydrogenase kinase isoform 1 in complex with glucose-lowering drug azd7545

PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1

SCOPe Domain Sequences for d2q8ga1:

Sequence, based on SEQRES records:

>d2q8ga1 a.29.5.0 (A:41-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvpgqvdfyarfspsplsmkqfldfgsvnacektsfmflrqelpvrlanimkeisllpdn
llrtpsvqlvqswyiqslqelldfkdksaedakaiydftdtvirirnrhndviptmaqgv
ieykesfgvdpvtsqnvqyfldrfymsrisirmllnqhsllf

Sequence, based on observed residues (ATOM records):

>d2q8ga1 a.29.5.0 (A:41-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvpgqvdfyarfspsplsmkqfldfgsvnacektsfmflrqelpvrlanimkeisllpdn
llrtpsvqlvqswyiqslqelldfkdksaedakaiydftdtvirirnrhndviptmaqgv
ieykesfdpvtsqnvqyfldrfymsrisirmllnqhsllf

Timeline for d2q8ga1:

• d2q8ga1 is new in SCOPe 2.04-stable
  
• d2q8ga1 appears in SCOPe 2.05
  
• d2q8ga1 appears in the current release, SCOPe 2.08