Lineage for d2q8ga1 (2q8g A:41-202)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708719Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 2708773Family a.29.5.0: automated matches [230678] (1 protein)
    not a true family
  6. 2708774Protein automated matches [230679] (2 species)
    not a true protein
  7. 2708775Species Human (Homo sapiens) [TaxId:9606] [230680] (8 PDB entries)
  8. 2708783Domain d2q8ga1: 2q8g A:41-202 [243526]
    Other proteins in same PDB: d2q8ga2
    automated match to d2bu8a1
    complexed with azx, k

Details for d2q8ga1

PDB Entry: 2q8g (more details), 1.9 Å

PDB Description: structure of pyruvate dehydrogenase kinase isoform 1 in complex with glucose-lowering drug azd7545
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1

SCOPe Domain Sequences for d2q8ga1:

Sequence, based on SEQRES records: (download)

>d2q8ga1 a.29.5.0 (A:41-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvpgqvdfyarfspsplsmkqfldfgsvnacektsfmflrqelpvrlanimkeisllpdn
llrtpsvqlvqswyiqslqelldfkdksaedakaiydftdtvirirnrhndviptmaqgv
ieykesfgvdpvtsqnvqyfldrfymsrisirmllnqhsllf

Sequence, based on observed residues (ATOM records): (download)

>d2q8ga1 a.29.5.0 (A:41-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvpgqvdfyarfspsplsmkqfldfgsvnacektsfmflrqelpvrlanimkeisllpdn
llrtpsvqlvqswyiqslqelldfkdksaedakaiydftdtvirirnrhndviptmaqgv
ieykesfdpvtsqnvqyfldrfymsrisirmllnqhsllf

SCOPe Domain Coordinates for d2q8ga1:

Click to download the PDB-style file with coordinates for d2q8ga1.
(The format of our PDB-style files is described here.)

Timeline for d2q8ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q8ga2