Lineage for d2q2ba_ (2q2b A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944462Species Mouse (Mus musculus) [TaxId:10090] [255553] (4 PDB entries)
  8. 2944469Domain d2q2ba_: 2q2b A: [243519]
    automated match to d1vpmc_

Details for d2q2ba_

PDB Entry: 2q2b (more details), 2.5 Å

PDB Description: Crystal structure of the C-terminal domain of mouse acyl-CoA thioesterase 7
PDB Compounds: (A:) cytosolic acyl coenzyme a thioester hydrolase

SCOPe Domain Sequences for d2q2ba_:

Sequence, based on SEQRES records: (download)

>d2q2ba_ d.38.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
epntvsysqsslihlvgpsdctlhgfvhggvtmklmdevagivaarhcktnivtasvdai
nfhdkirkgcvitisgrmtftsnksmeievlvdadpvvdnsqkryraasafftyvslnqe
gkpmpvpqlvpetedekkrfeegkgrylqm

Sequence, based on observed residues (ATOM records): (download)

>d2q2ba_ d.38.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
epntvsysqsslihlvghgfvhggvtmklmdevagivaarhcktnivtasvdainfhdki
rkgcvitisgrmtftsnksmeievlvdadpvvdkryraasafftyvslnqegkpmpvpql
vpetedekkrfeegkgrylqm

SCOPe Domain Coordinates for d2q2ba_:

Click to download the PDB-style file with coordinates for d2q2ba_.
(The format of our PDB-style files is described here.)

Timeline for d2q2ba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2q2bb_