SCOPe 2.06: Domain d2q17d_: 2q17 D:

Lineage for d2q17d_ (2q17 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [255552] (1 PDB entry)

8. Domain d2q17d_: 2q17 D: [243516]
   automated match to d1y1hx_
   complexed with ca

Details for d2q17d_

PDB Entry: 2q17, 2.1 Å

PDB Description: Formylglycine Generating Enzyme from Streptomyces coelicolor

PDB Compounds: (D:) formylglycine generating enzyme

SCOPe Domain Sequences for d2q17d_:

Sequence; same for both SEQRES and ATOM records:

>d2q17d_ d.169.1.0 (D:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
prstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafvkat
ghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgrpnh
pvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniwqgr
fphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphgpgt
gaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcanda

Timeline for d2q17d_:

• d2q17d_ first appeared in SCOPe 2.04
  
• d2q17d_ appears in SCOPe 2.05
  
• d2q17d_ appears in SCOPe 2.07
  
• d2q17d_ appears in the current release, SCOPe 2.08