Lineage for d2q17b_ (2q17 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002768Species Streptomyces coelicolor [TaxId:100226] [255552] (2 PDB entries)
  8. 3002770Domain d2q17b_: 2q17 B: [243514]
    automated match to d1y1hx_
    complexed with ca

Details for d2q17b_

PDB Entry: 2q17 (more details), 2.1 Å

PDB Description: Formylglycine Generating Enzyme from Streptomyces coelicolor
PDB Compounds: (B:) formylglycine generating enzyme

SCOPe Domain Sequences for d2q17b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q17b_ d.169.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
rprstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafvka
tghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgrpn
hpvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniwqg
rfphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphgpg
tgaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandad

SCOPe Domain Coordinates for d2q17b_:

Click to download the PDB-style file with coordinates for d2q17b_.
(The format of our PDB-style files is described here.)

Timeline for d2q17b_: