Lineage for d2pzja_ (2pzj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094509Species Bordetella bronchiseptica [TaxId:518] [225344] (8 PDB entries)
  8. 2094511Domain d2pzja_: 2pzj A: [243507]
    automated match to d1r6da_
    complexed with nad

Details for d2pzja_

PDB Entry: 2pzj (more details), 1.9 Å

PDB Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmF in complex with NAD+
PDB Compounds: (A:) Putative nucleotide sugar epimerase/ dehydratase

SCOPe Domain Sequences for d2pzja_:

Sequence, based on SEQRES records: (download)

>d2pzja_ c.2.1.0 (A:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
sklantnvmvvggagfvgsnlvkrllelgvnqvhvvdnllsaekinvpdhpavrfsetsi
tddallaslqdeydyvfhlatyhgnqssihdpladhenntlttlklyerlkhfkrlkkvv
ysaagcsiaektfddakateetdivslhnndspysmskifgefysvyyhkqhqlptvrar
fqnvygpgeilgagrwrgtpatvwrnvtptfiykalkgmplplenggvatrdfifvedva
ngliacaadgtpggvyniasgketsiadlatkineitgnnteldrlpkrpwdnsgkrfgs
pekarrelgfsadvsiddglrktiewtkanlavieqimrkhdsalaty

Sequence, based on observed residues (ATOM records): (download)

>d2pzja_ c.2.1.0 (A:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
sklantnvmvvggagfvgsnlvkrllelgvnqvhvvdnllsaekinvpdhpavrfsetsi
tddallaslqdeydyvfhlatyhgnqssihdpladhenntlttlklyerlkhfkrlkkvv
ysaageetdivslhnndspysmskifgefysvyyhkqhqlptvrarfqnvygpgeilgag
rwrgtpatvwrnvtptfiykalkgmplplenggvatrdfifvedvangliacaadgtpgg
vyniasgketsiadlatkineitgnnteldrlpkrpwdnsgspekarrelgfsadvsidd
glrktiewtkanlavieqimrkhdsalaty

SCOPe Domain Coordinates for d2pzja_:

Click to download the PDB-style file with coordinates for d2pzja_.
(The format of our PDB-style files is described here.)

Timeline for d2pzja_: