SCOPe 2.05: Domain d2py1a_: 2py1 A:

Lineage for d2py1a_ (2py1 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver fatty acid binding protein [50866] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141464] (19 PDB entries)
   Uniprot P07148 1-127

8. Domain d2py1a_: 2py1 A: [243505]
   automated match to d1vyfa_

Details for d2py1a_

PDB Entry: 2py1

PDB Description: solution structure of human liver fatty acid binding protein

PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d2py1a_:

Sequence; same for both SEQRES and ATOM records:

>d2py1a_ b.60.1.2 (A:) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
gsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskv
iqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdi
vfkriskri

Timeline for d2py1a_:

• d2py1a_ first appeared in SCOPe 2.04
  
• d2py1a_ is called d2py1a1 in SCOPe 2.06
  
• d2py1a_ appears in the current release, SCOPe 2.08, called d2py1a1