Lineage for d2pwqa_ (2pwq A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898682Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1898683Protein automated matches [190120] (6 species)
    not a true protein
  7. 1898714Species Plasmodium yoelii [TaxId:5861] [255550] (1 PDB entry)
  8. 1898715Domain d2pwqa_: 2pwq A: [243504]
    automated match to d3l1ya_

Details for d2pwqa_

PDB Entry: 2pwq (more details), 1.9 Å

PDB Description: Crystal structure of a putative ubiquitin conjugating enzyme from Plasmodium yoelii
PDB Compounds: (A:) ubiquitin conjugating enzyme

SCOPe Domain Sequences for d2pwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwqa_ d.20.1.0 (A:) automated matches {Plasmodium yoelii [TaxId: 5861]}
fqgskellrlqkelkdienenvqeidahikdsnffewvgfikgpegtpyegghftlaiti
pndypynppkikfvtkiwhpnissqtgaicldvlknewspaltirtallsiqallsdpqp
ddpqdaevakmykenhalfvktasvwtktfatgp

SCOPe Domain Coordinates for d2pwqa_:

Click to download the PDB-style file with coordinates for d2pwqa_.
(The format of our PDB-style files is described here.)

Timeline for d2pwqa_: