![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
![]() | Protein automated matches [190120] (9 species) not a true protein |
![]() | Species Plasmodium yoelii [TaxId:5861] [255550] (1 PDB entry) |
![]() | Domain d2pwqa1: 2pwq A:1-151 [243504] Other proteins in same PDB: d2pwqa2 automated match to d3l1ya_ |
PDB Entry: 2pwq (more details), 1.9 Å
SCOPe Domain Sequences for d2pwqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pwqa1 d.20.1.0 (A:1-151) automated matches {Plasmodium yoelii [TaxId: 5861]} skellrlqkelkdienenvqeidahikdsnffewvgfikgpegtpyegghftlaitipnd ypynppkikfvtkiwhpnissqtgaicldvlknewspaltirtallsiqallsdpqpddp qdaevakmykenhalfvktasvwtktfatgp
Timeline for d2pwqa1: