SCOPe 2.08: Domain d2pwqa1: 2pwq A:1-151

Lineage for d2pwqa1 (2pwq A:1-151)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (9 species)
   not a true protein

7. Species Plasmodium yoelii [TaxId:5861] [255550] (1 PDB entry)

8. Domain d2pwqa1: 2pwq A:1-151 [243504]
   Other proteins in same PDB: d2pwqa2
   automated match to d3l1ya_

Details for d2pwqa1

PDB Entry: 2pwq, 1.9 Å

PDB Description: Crystal structure of a putative ubiquitin conjugating enzyme from Plasmodium yoelii

PDB Compounds: (A:) ubiquitin conjugating enzyme

SCOPe Domain Sequences for d2pwqa1:

Sequence; same for both SEQRES and ATOM records:

>d2pwqa1 d.20.1.0 (A:1-151) automated matches {Plasmodium yoelii [TaxId: 5861]}
skellrlqkelkdienenvqeidahikdsnffewvgfikgpegtpyegghftlaitipnd
ypynppkikfvtkiwhpnissqtgaicldvlknewspaltirtallsiqallsdpqpddp
qdaevakmykenhalfvktasvwtktfatgp

Timeline for d2pwqa1:

• d2pwqa1 first appeared in SCOPe 2.04, called d2pwqa_
  
• d2pwqa1 appears in SCOPe 2.07