Lineage for d2pvsb1 (2pvs B:-2-336)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135356Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 protein domains)
    automatically mapped to Pfam PF00151
  6. 2135374Protein automated matches [226890] (2 species)
    not a true protein
  7. 2135377Species Human (Homo sapiens) [TaxId:9606] [225244] (3 PDB entries)
  8. 2135380Domain d2pvsb1: 2pvs B:-2-336 [243502]
    Other proteins in same PDB: d2pvsa2, d2pvsb2
    automated match to d2oxea1
    complexed with ca, so4; mutant

Details for d2pvsb1

PDB Entry: 2pvs (more details), 3 Å

PDB Description: Structure of human pancreatic lipase related protein 2 mutant N336Q
PDB Compounds: (B:) Pancreatic lipase-related protein 2

SCOPe Domain Sequences for d2pvsb1:

Sequence, based on SEQRES records: (download)

>d2pvsb1 c.69.1.19 (B:-2-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kevcygqlgcfsdekpwagtlqrpvkllpwspedidtrfllytnenpnnfqlitgtepdt
ieasnfqldrktrfiihgfldkaedswpsdmckkmfevekvncicvdwrhgsramytqav
qnirvvgaetafliqalstqlgysledvhvighslgahtaaeagrrlggrvgritgldpa
gpcfqdepeevrldpsdavfvdvihtdsspivpslgfgmsqkvghldffpnggkempgck
knvlstitdidgiwegiggfvscnhlrsfeyysssvlnpdgflgypcasydefqeskcfp
cpaegcpkmghyadqfkgktsaveqtfflntgesgqft

Sequence, based on observed residues (ATOM records): (download)

>d2pvsb1 c.69.1.19 (B:-2-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kevcygqlgcfsdekpwagtlqrpvkllpwspedidtrfllytnenpnnfqlitgtepdt
ieasnfqldrktrfiihgfldkaedswpsdmckkmfevekvncicvdwrhgsramytqav
qnirvvgaetafliqalstqlgysledvhvighslgahtaaeagrrlggrvgritgldpa
gpcfqdepeevrldpsdavfvdvihtdsspivpslgfgmsqkvghldffpnggkempgck
knidgiwegiggfvscnhlrsfeyysssvlnpdgflgypcasydefqeskcfpcpaegcp
kmghyadqfkgktsaveqtfflntgesgqft

SCOPe Domain Coordinates for d2pvsb1:

Click to download the PDB-style file with coordinates for d2pvsb1.
(The format of our PDB-style files is described here.)

Timeline for d2pvsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pvsb2