SCOPe 2.07: Domain d2pvsa2: 2pvs A:337-450

Lineage for d2pvsa2 (2pvs A:337-450)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.0: automated matches [227174] (1 protein)
   not a true family

6. Protein automated matches [226891] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225245] (9 PDB entries)

8. Domain d2pvsa2: 2pvs A:337-450 [243501]
   Other proteins in same PDB: d2pvsa1, d2pvsb1
   automated match to d2oxea2
   complexed with ca, so4; mutant

Details for d2pvsa2

PDB Entry: 2pvs, 3 Å

PDB Description: structure of human pancreatic lipase related protein 2 mutant n336q

PDB Compounds: (A:) Pancreatic lipase-related protein 2

SCOPe Domain Sequences for d2pvsa2:

Sequence, based on SEQRES records:

>d2pvsa2 b.12.1.0 (A:337-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki
qkvkflwnkrginlsepklgasqitvqsgedgteynfcssdtveenvlqslypc

Sequence, based on observed residues (ATOM records):

>d2pvsa2 b.12.1.0 (A:337-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki
qkvkflwnknlsepklgasqitvqsgedgteynfcssdtveenvlqslypc

Timeline for d2pvsa2:

• d2pvsa2 first appeared in SCOPe 2.04
  
• d2pvsa2 appears in SCOPe 2.06
  
• d2pvsa2 appears in the current release, SCOPe 2.08