Lineage for d2pvsa2 (2pvs A:337-450)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038801Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2038802Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2038875Family b.12.1.0: automated matches [227174] (1 protein)
    not a true family
  6. 2038876Protein automated matches [226891] (5 species)
    not a true protein
  7. 2038881Species Human (Homo sapiens) [TaxId:9606] [225245] (7 PDB entries)
  8. 2038887Domain d2pvsa2: 2pvs A:337-450 [243501]
    Other proteins in same PDB: d2pvsa1, d2pvsb1
    automated match to d2oxea2
    complexed with ca, so4; mutant

Details for d2pvsa2

PDB Entry: 2pvs (more details), 3 Å

PDB Description: Structure of human pancreatic lipase related protein 2 mutant N336Q
PDB Compounds: (A:) Pancreatic lipase-related protein 2

SCOPe Domain Sequences for d2pvsa2:

Sequence, based on SEQRES records: (download)

>d2pvsa2 b.12.1.0 (A:337-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki
qkvkflwnkrginlsepklgasqitvqsgedgteynfcssdtveenvlqslypc

Sequence, based on observed residues (ATOM records): (download)

>d2pvsa2 b.12.1.0 (A:337-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki
qkvkflwnknlsepklgasqitvqsgedgteynfcssdtveenvlqslypc

SCOPe Domain Coordinates for d2pvsa2:

Click to download the PDB-style file with coordinates for d2pvsa2.
(The format of our PDB-style files is described here.)

Timeline for d2pvsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pvsa1