Lineage for d1bgmi4 (1bgm I:731-1023)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165166Superfamily b.30.5: Galactose mutarotase-like [74650] (4 families) (S)
  5. 165167Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 165168Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 165169Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 165226Domain d1bgmi4: 1bgm I:731-1023 [24350]
    Other proteins in same PDB: d1bgmi1, d1bgmi2, d1bgmi3, d1bgmi5, d1bgmj1, d1bgmj2, d1bgmj3, d1bgmj5, d1bgmk1, d1bgmk2, d1bgmk3, d1bgmk5, d1bgml1, d1bgml2, d1bgml3, d1bgml5, d1bgmm1, d1bgmm2, d1bgmm3, d1bgmm5, d1bgmn1, d1bgmn2, d1bgmn3, d1bgmn5, d1bgmo1, d1bgmo2, d1bgmo3, d1bgmo5, d1bgmp1, d1bgmp2, d1bgmp3, d1bgmp5

Details for d1bgmi4

PDB Entry: 1bgm (more details), 2.5 Å

PDB Description: beta-galactosidase (chains i-p)

SCOP Domain Sequences for d1bgmi4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgmi4 b.30.5.1 (I:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1bgmi4:

Click to download the PDB-style file with coordinates for d1bgmi4.
(The format of our PDB-style files is described here.)

Timeline for d1bgmi4: