Lineage for d2pqqd1 (2pqq D:3-145)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2071306Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2071539Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2071540Protein automated matches [226927] (14 species)
    not a true protein
  7. 2071598Species Streptomyces coelicolor [TaxId:100226] [255548] (1 PDB entry)
  8. 2071602Domain d2pqqd1: 2pqq D:3-145 [243496]
    Other proteins in same PDB: d2pqqa2, d2pqqa3, d2pqqb2, d2pqqc2, d2pqqd2
    automated match to d3i54a1
    complexed with fmt

Details for d2pqqd1

PDB Entry: 2pqq (more details), 2 Å

PDB Description: structural genomics, the crystal structure of the n-terminal domain of a transcriptional regulator from streptomyces coelicolor a3(2)
PDB Compounds: (D:) Putative transcriptional regulator

SCOPe Domain Sequences for d2pqqd1:

Sequence, based on SEQRES records: (download)

>d2pqqd1 b.82.3.0 (D:3-145) automated matches {Streptomyces coelicolor [TaxId: 100226]}
dvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrtsp
dgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpevata
llravarrlrktndamsdlvfsd

Sequence, based on observed residues (ATOM records): (download)

>d2pqqd1 b.82.3.0 (D:3-145) automated matches {Streptomyces coelicolor [TaxId: 100226]}
dvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrtsp
dgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpevata
llravarrlrktndamlvfsd

SCOPe Domain Coordinates for d2pqqd1:

Click to download the PDB-style file with coordinates for d2pqqd1.
(The format of our PDB-style files is described here.)

Timeline for d2pqqd1: