SCOPe 2.08: Domain d2ppha1: 2pph A:1-85

Lineage for d2ppha1 (2pph A:1-85)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (11 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein automated matches [190335] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187157] (2 PDB entries)

8. Domain d2ppha1: 2pph A:1-85 [243491]
   Other proteins in same PDB: d2ppha2
   automated match to d2cu1a1

Details for d2ppha1

PDB Entry: 2pph

PDB Description: solution structure of human mekk3 pb1 domain

PDB Compounds: (A:) Mitogen-activated protein kinase kinase kinase 3

SCOPe Domain Sequences for d2ppha1:

Sequence; same for both SEQRES and ATOM records:

>d2ppha1 d.15.2.2 (A:1-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddld
kaidildrsssmkslrilllsqdrn

Timeline for d2ppha1:

• d2ppha1 first appeared in SCOPe 2.04, called d2ppha_
  
• d2ppha1 appears in SCOPe 2.07