Lineage for d1dp0d4 (1dp0 D:731-1023)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58106Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 58107Superfamily b.30.1: beta-Galactosidase, domain 5 [49994] (1 family) (S)
  5. 58108Family b.30.1.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 58109Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 58110Species Escherichia coli [TaxId:562] [49997] (7 PDB entries)
  8. 58114Domain d1dp0d4: 1dp0 D:731-1023 [24349]
    Other proteins in same PDB: d1dp0a1, d1dp0a2, d1dp0a3, d1dp0a5, d1dp0b1, d1dp0b2, d1dp0b3, d1dp0b5, d1dp0c1, d1dp0c2, d1dp0c3, d1dp0c5, d1dp0d1, d1dp0d2, d1dp0d3, d1dp0d5

Details for d1dp0d4

PDB Entry: 1dp0 (more details), 1.7 Å

PDB Description: e. coli beta-galactosidase at 1.7 angstrom

SCOP Domain Sequences for d1dp0d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp0d4 b.30.1.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1dp0d4:

Click to download the PDB-style file with coordinates for d1dp0d4.
(The format of our PDB-style files is described here.)

Timeline for d1dp0d4: