Lineage for d2pn6a1 (2pn6 A:1-60)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695139Species Sulfolobus tokodaii [TaxId:273063] [230698] (7 PDB entries)
  8. 2695140Domain d2pn6a1: 2pn6 A:1-60 [243488]
    Other proteins in same PDB: d2pn6a2
    automated match to d2efna1
    complexed with gln, mg

Details for d2pn6a1

PDB Entry: 2pn6 (more details), 1.44 Å

PDB Description: crystal structure of s32a of st1022-gln complex from sulfolobus tokodaii
PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2pn6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pn6a1 a.4.5.0 (A:1-60) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mdeidlrilkilqynakysldeiareiripkatlsyrikklekdgvikgyyayinpasln

SCOPe Domain Coordinates for d2pn6a1:

Click to download the PDB-style file with coordinates for d2pn6a1.
(The format of our PDB-style files is described here.)

Timeline for d2pn6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pn6a2