Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (6 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries) |
Domain d2pgze1: 2pgz E:1-207 [243482] Other proteins in same PDB: d2pgza2, d2pgzb2, d2pgzc2, d2pgzd2, d2pgze2 automated match to d2c9ta_ complexed with coc, nag, pg4 |
PDB Entry: 2pgz (more details), 1.76 Å
SCOPe Domain Sequences for d2pgze1:
Sequence, based on SEQRES records: (download)
>d2pgze1 b.96.1.0 (E:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrer
>d2pgze1 b.96.1.0 (E:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwklns lmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrls fmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtrq vqhysccpepyidvnlvvkfrer
Timeline for d2pgze1: