Lineage for d2pgza1 (2pgz A:1-207)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2085014Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2085015Protein automated matches [193506] (6 species)
    not a true protein
  7. 2085046Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)
  8. 2085052Domain d2pgza1: 2pgz A:1-207 [243478]
    Other proteins in same PDB: d2pgza2, d2pgzb2, d2pgzc2, d2pgzd2, d2pgze2
    automated match to d2c9ta_
    complexed with coc, nag, pg4

Details for d2pgza1

PDB Entry: 2pgz (more details), 1.76 Å

PDB Description: crystal structure of cocaine bound to an ach-binding protein
PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2pgza1:

Sequence, based on SEQRES records: (download)

>d2pgza1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d2pgza1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrsypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2pgza1:

Click to download the PDB-style file with coordinates for d2pgza1.
(The format of our PDB-style files is described here.)

Timeline for d2pgza1: