SCOPe 2.07: Domain d2pbcc1: 2pbc C:43-140

Lineage for d2pbcc1 (2pbc C:43-140)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)

8. Domain d2pbcc1: 2pbc C:43-140 [243467]
   Other proteins in same PDB: d2pbca2, d2pbcb2, d2pbcc2, d2pbcd2
   automated match to d4nnrb_
   complexed with peg

Details for d2pbcc1

PDB Entry: 2pbc, 1.8 Å

PDB Description: FK506-binding protein 2

PDB Compounds: (C:) FK506-binding protein 2

SCOPe Domain Sequences for d2pbcc1:

Sequence; same for both SEQRES and ATOM records:

>d2pbcc1 d.26.1.0 (C:43-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
piksrkgdvlhmhytgkledgtefdsslpqnqpfvfslgtgqvikgwdqgllgmcegekr
klvipselgygergappkipggatlvfevellkierrt

Timeline for d2pbcc1:

• d2pbcc1 first appeared in SCOPe 2.04, called d2pbcc_
  
• d2pbcc1 appears in SCOPe 2.06
  
• d2pbcc1 appears in the current release, SCOPe 2.08