Lineage for d2pbca1 (2pbc A:43-140)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548747Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2548748Protein automated matches [191162] (29 species)
    not a true protein
  7. 2548810Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)
  8. 2548827Domain d2pbca1: 2pbc A:43-140 [243465]
    Other proteins in same PDB: d2pbca2, d2pbcb2, d2pbcc2, d2pbcd2
    automated match to d4nnrb_
    complexed with peg

Details for d2pbca1

PDB Entry: 2pbc (more details), 1.8 Å

PDB Description: FK506-binding protein 2
PDB Compounds: (A:) FK506-binding protein 2

SCOPe Domain Sequences for d2pbca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pbca1 d.26.1.0 (A:43-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
piksrkgdvlhmhytgkledgtefdsslpqnqpfvfslgtgqvikgwdqgllgmcegekr
klvipselgygergappkipggatlvfevellkierrt

SCOPe Domain Coordinates for d2pbca1:

Click to download the PDB-style file with coordinates for d2pbca1.
(The format of our PDB-style files is described here.)

Timeline for d2pbca1: