Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [255544] (9 PDB entries) |
Domain d2pb0b_: 2pb0 B: [243462] automated match to d4adba_ complexed with edo, plp |
PDB Entry: 2pb0 (more details), 1.96 Å
SCOPe Domain Sequences for d2pb0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pb0b_ c.67.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]} lpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwht snvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiaf hnafhgrslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqg eggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakal gggfpvsamlttqeiasafhvgshgstyggnplacavagaafdiintpevlqgihtkrqq fvqhlqaideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmr fapslvveeadihegmqrfaqavgkvv
Timeline for d2pb0b_: