SCOPe 2.04: Domain d2p9rb_: 2p9r B:

Lineage for d2p9rb_ (2p9r B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.29: Macroglobulin [254121] (8 families)
   C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations

5. Family b.1.29.3: Complement C3 MG2-like [254156] (3 proteins)
   Pfam PF01835

6. Protein Alpha-2-macroglobulin MG2 [254351] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254784] (1 PDB entry)

8. Domain d2p9rb_: 2p9r B: [243460]

Details for d2p9rb_

PDB Entry: 2p9r, 2.3 Å

PDB Description: Human alpha2-macroglogulin is composed of multiple domains, as predicted by homology with complement component C3

PDB Compounds: (B:) alpha-2-macroglobulin

SCOPe Domain Sequences for d2p9rb_:

Sequence; same for both SEQRES and ATOM records:

>d2p9rb_ b.1.29.3 (B:) Alpha-2-macroglobulin MG2 {Human (Homo sapiens) [TaxId: 9606]}
dslvfvqtdksiykpgqtvkfrvvsmdenfhplneliplvyiqdpkgnriaqwqsfqleg
glkqfsfplssepfqgsykvvvqkksggrtehpftve

Timeline for d2p9rb_:

• d2p9rb_ is new in SCOPe 2.04-stable
  
• d2p9rb_ appears in SCOPe 2.05
  
• d2p9rb_ appears in the current release, SCOPe 2.08