Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.29: Macroglobulin [254121] (8 families) C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations |
Family b.1.29.3: Complement C3 MG2-like [254156] (3 proteins) Pfam PF01835 |
Protein Alpha-2-macroglobulin MG2 [254351] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254784] (1 PDB entry) |
Domain d2p9rb_: 2p9r B: [243460] |
PDB Entry: 2p9r (more details), 2.3 Å
SCOPe Domain Sequences for d2p9rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9rb_ b.1.29.3 (B:) Alpha-2-macroglobulin MG2 {Human (Homo sapiens) [TaxId: 9606]} dslvfvqtdksiykpgqtvkfrvvsmdenfhplneliplvyiqdpkgnriaqwqsfqleg glkqfsfplssepfqgsykvvvqkksggrtehpftve
Timeline for d2p9rb_: