Lineage for d2p9rb_ (2p9r B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766890Superfamily b.1.29: Macroglobulin [254121] (9 families) (S)
    C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations
  5. 2766917Family b.1.29.3: Complement C3 MG2-like [254156] (3 proteins)
    Pfam PF01835
  6. 2766918Protein Alpha-2-macroglobulin MG2 [254351] (1 species)
  7. 2766919Species Human (Homo sapiens) [TaxId:9606] [254784] (1 PDB entry)
  8. 2766921Domain d2p9rb_: 2p9r B: [243460]

Details for d2p9rb_

PDB Entry: 2p9r (more details), 2.3 Å

PDB Description: Human alpha2-macroglogulin is composed of multiple domains, as predicted by homology with complement component C3
PDB Compounds: (B:) alpha-2-macroglobulin

SCOPe Domain Sequences for d2p9rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9rb_ b.1.29.3 (B:) Alpha-2-macroglobulin MG2 {Human (Homo sapiens) [TaxId: 9606]}
dslvfvqtdksiykpgqtvkfrvvsmdenfhplneliplvyiqdpkgnriaqwqsfqleg
glkqfsfplssepfqgsykvvvqkksggrtehpftve

SCOPe Domain Coordinates for d2p9rb_:

Click to download the PDB-style file with coordinates for d2p9rb_.
(The format of our PDB-style files is described here.)

Timeline for d2p9rb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p9ra_