SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2p76f1 (2p76 F:44-309)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089342Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2089425Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 2089426Protein automated matches [190919] (11 species)
    not a true protein
  7. 2089453Species Staphylococcus aureus [TaxId:158879] [231089] (2 PDB entries)
  8. 2089465Domain d2p76f1: 2p76 F:44-309 [243453]
    Other proteins in same PDB: d2p76a2, d2p76b2, d2p76c2, d2p76d2, d2p76e2, d2p76f2, d2p76g2, d2p76h2
    automated match to d2ooga_
    complexed with gol, na

Details for d2p76f1

PDB Entry: 2p76 (more details), 2.6 Å

PDB Description: Crystal structure of a Glycerophosphodiester Phosphodiesterase from Staphylococcus aureus
PDB Compounds: (F:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d2p76f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p76f1 c.1.18.0 (F:44-309) automated matches {Staphylococcus aureus [TaxId: 158879]}
qwhtnltnerfttiahrgasgyapehtfqaydkshnelkasyieidlqrtkdghlvamhd
etvnrttnghgkvedytldelkqldagswfnkkypkyarasyknakvptldeilerygpn
anyyietkspdvypgmeeqllaslkkhhllnnnklknghvmiqsfsdeslkkihrqnkhv
plvklvdkgelqqfndqrlkeirsyaiglgpdytdlteqnthhlkdlgfivhpytvneka
dmlrlnkygvdgvftnfadkykevik

SCOPe Domain Coordinates for d2p76f1:

Click to download the PDB-style file with coordinates for d2p76f1.
(The format of our PDB-style files is described here.)

Timeline for d2p76f1: