Lineage for d1nlra_ (1nlr A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051304Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2051305Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 2051329Species Streptomyces lividans, CelB2 [TaxId:1916] [49992] (2 PDB entries)
  8. 2051331Domain d1nlra_: 1nlr A: [24345]

Details for d1nlra_

PDB Entry: 1nlr (more details), 1.75 Å

PDB Description: endo-1,4-beta-glucanase celb2, cellulase, native structure
PDB Compounds: (A:) endo-1,4-beta-glucanase

SCOPe Domain Sequences for d1nlra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlra_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Streptomyces lividans, CelB2 [TaxId: 1916]}
dtticepfgtttiqgryvvqnnrwgstapqcvtatdtgfrvtqadgsaptngapksypsv
fngchytncspgtdlpvrldtvsaapssisygfvdgavynasydiwldptartdgvnqte
imiwfnrvgpiqpigspvgtasvggrtwevwsggngsndvlsfvapsaisgwsfdvmdfv
ratvarglaendwyltsvqagfepwqngaglavnsfsstvet

SCOPe Domain Coordinates for d1nlra_:

Click to download the PDB-style file with coordinates for d1nlra_.
(The format of our PDB-style files is described here.)

Timeline for d1nlra_: