Lineage for d1nlr__ (1nlr -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371831Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 371832Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 371846Species Streptomyces lividans, CelB2 [TaxId:1916] [49992] (2 PDB entries)
  8. 371848Domain d1nlr__: 1nlr - [24345]
    complexed with mho

Details for d1nlr__

PDB Entry: 1nlr (more details), 1.75 Å

PDB Description: endo-1,4-beta-glucanase celb2, cellulase, native structure

SCOP Domain Sequences for d1nlr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlr__ b.29.1.11 (-) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Streptomyces lividans, CelB2}
dtticepfgtttiqgryvvqnnrwgstapqcvtatdtgfrvtqadgsaptngapksypsv
fngchytncspgtdlpvrldtvsaapssisygfvdgavynasydiwldptartdgvnqte
imiwfnrvgpiqpigspvgtasvggrtwevwsggngsndvlsfvapsaisgwsfdvmdfv
ratvarglaendwyltsvqagfepwqngaglavnsfsstvet

SCOP Domain Coordinates for d1nlr__:

Click to download the PDB-style file with coordinates for d1nlr__.
(The format of our PDB-style files is described here.)

Timeline for d1nlr__: