Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Neisseria meningitidis [TaxId:122586] [231118] (3 PDB entries) |
Domain d2p6ta1: 2p6t A:3-65 [243432] Other proteins in same PDB: d2p6ta2, d2p6tb2, d2p6tc2, d2p6td2, d2p6te2, d2p6tf2, d2p6tg2, d2p6th2 automated match to d2p5vb1 complexed with ca, gol, leu |
PDB Entry: 2p6t (more details), 2.9 Å
SCOPe Domain Sequences for d2p6ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6ta1 a.4.5.0 (A:3-65) automated matches {Neisseria meningitidis [TaxId: 122586]} qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe svn
Timeline for d2p6ta1: