Lineage for d1f5jb_ (1f5j B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 58044Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins)
  6. 58056Protein Xylanase II [49979] (11 species)
  7. 58082Species Dictyoglomus thermophilum [TaxId:14] [49990] (1 PDB entry)
  8. 58084Domain d1f5jb_: 1f5j B: [24343]

Details for d1f5jb_

PDB Entry: 1f5j (more details), 1.8 Å

PDB Description: crystal structure of xynb, a highly thermostable beta-1,4-xylanase from dictyoglomus thermophilum rt46b.1, at 1.8 a resolution

SCOP Domain Sequences for d1f5jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5jb_ b.29.1.11 (B:) Xylanase II {Dictyoglomus thermophilum}
altsnasgtfdgyyyelwkdtgnttmtvytqgrfscqwsninnalfrtgkkynqnwqslg
tiritysatynpngnsylciygwstnplvefyiveswgnwrppgatslgqvtidggtydi
yrttrvnqpsivgtatfdqywsvrtskrtsgtvtvtdhfrawanrglnlgtidqitlcve
gyqssgsanitqntfsqss

SCOP Domain Coordinates for d1f5jb_:

Click to download the PDB-style file with coordinates for d1f5jb_.
(The format of our PDB-style files is described here.)

Timeline for d1f5jb_: