| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
| Protein automated matches [190081] (33 species) not a true protein |
| Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries) |
| Domain d2p6sb2: 2p6s B:66-158 [243419] Other proteins in same PDB: d2p6sa1, d2p6sb1, d2p6sc1, d2p6sd1, d2p6se1, d2p6sf1, d2p6sg1, d2p6sh1 automated match to d2p5vb2 complexed with ca, gol, met |
PDB Entry: 2p6s (more details), 2.8 Å
SCOPe Domain Sequences for d2p6sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6sb2 d.58.4.0 (B:66-158) automated matches {Neisseria meningitidis [TaxId: 122586]}
lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl
dtllshhgvqdaqssfvlkeikhttslplnhll
Timeline for d2p6sb2: