SCOPe 2.08: Domain d2p5xb_: 2p5x B:

Lineage for d2p5xb_ (2p5x B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187020] (7 PDB entries)

8. Domain d2p5xb_: 2p5x B: [243414]
   automated match to d1ex2a_
   complexed with po4

Details for d2p5xb_

PDB Entry: 2p5x, 2 Å

PDB Description: Crystal structure of Maf domain of human N-acetylserotonin O-methyltransferase-like protein

PDB Compounds: (B:) N-acetylserotonin O-methyltransferase-like protein

SCOPe Domain Sequences for d2p5xb_:

Sequence, based on SEQRES records:

>d2p5xb_ c.51.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llhkrvvlasasprrqeilsnaglrfevvpskfkekldkasfatpygyametakqkalev
anrlyqkdlrapdvvigadtivtvgglilekpvdkqdayrmlsrlsgrehsvftgvaivh
csskdhqldtrvsefyeetkvkfselseellweyvhsgepmdkaggygiqalggmlvesv
hgdflnvvgfplnhfckqlvklyy

Sequence, based on observed residues (ATOM records):

>d2p5xb_ c.51.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llhkrvvlasasprrqeilsnaglrfevvpskfkekldkasfatpygyametakqkalev
anrlyqkdlrapdvvigadtivtvgglilekpvdkqdayrmlsrlsgrehsvftgvaivh
csskdhqldtrvsefyeetkvkfselseellweyvhsgepmdkaggygiqgmlvesvhgd
flnvvgfplnhfckqlvklyy

Timeline for d2p5xb_:

• d2p5xb_ first appeared in SCOPe 2.04
  
• d2p5xb_ appears in SCOPe 2.07