Lineage for d2p51a_ (2p51 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887243Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255540] (3 PDB entries)
  8. 2887244Domain d2p51a_: 2p51 A: [243410]
    automated match to d2d5ra1
    complexed with mg

Details for d2p51a_

PDB Entry: 2p51 (more details), 1.4 Å

PDB Description: crystal structure of the s. pombe pop2p deadenylation subunit
PDB Compounds: (A:) SPCC18.06c protein

SCOPe Domain Sequences for d2p51a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p51a_ c.55.3.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sqispirdvwstnlqqemnlimslierypvvsmdtefpgvvarplgvfkssddyhyqtlr
anvdslkiiqiglalsdeegnapveactwqfnftfnlqddmyapesielltksgidfkkh
qevgiepadfaelligsglvlqeevtwitfhsgydfayllkamtqiplpaeyeefykilc
iyfpknydikyimksvlnnskglqdiaddlqihrigpqhqagsdalltariffeirsryf
dgsidsrmlnqlygl

SCOPe Domain Coordinates for d2p51a_:

Click to download the PDB-style file with coordinates for d2p51a_.
(The format of our PDB-style files is described here.)

Timeline for d2p51a_: