Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (19 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Paecilomyces variotii, Bainier 1907 [TaxId:45996] [49989] (1 PDB entry) |
Domain d1pvxa_: 1pvx A: [24341] |
PDB Entry: 1pvx (more details), 1.59 Å
SCOPe Domain Sequences for d1pvxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvxa_ b.29.1.11 (A:) Xylanase II {Paecilomyces variotii, Bainier 1907 [TaxId: 45996]} gttpnsegwhdgyyyswwsdgggdstytnnsggtyeitwgnggnlvggkgwnpglnarai hftgvyqpngtsylsvygwtrnplveyyivenfgssnpssgstdlgtvscdgstytlgqs trynapsidgtqtfnqywsvrqdkrssgtvqtgchfdawasaglnvtgdhyyqivategy fssgyaritvadvg
Timeline for d1pvxa_: