Lineage for d1pvxa_ (1pvx A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051304Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2051349Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2051432Species Paecilomyces variotii, Bainier 1907 [TaxId:45996] [49989] (1 PDB entry)
  8. 2051433Domain d1pvxa_: 1pvx A: [24341]

Details for d1pvxa_

PDB Entry: 1pvx (more details), 1.59 Å

PDB Description: do-1,4-beta-xylanase, room temperature, ph 4.5
PDB Compounds: (A:) protein (endo-1,4-beta-xylanase)

SCOPe Domain Sequences for d1pvxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvxa_ b.29.1.11 (A:) Xylanase II {Paecilomyces variotii, Bainier 1907 [TaxId: 45996]}
gttpnsegwhdgyyyswwsdgggdstytnnsggtyeitwgnggnlvggkgwnpglnarai
hftgvyqpngtsylsvygwtrnplveyyivenfgssnpssgstdlgtvscdgstytlgqs
trynapsidgtqtfnqywsvrqdkrssgtvqtgchfdawasaglnvtgdhyyqivategy
fssgyaritvadvg

SCOPe Domain Coordinates for d1pvxa_:

Click to download the PDB-style file with coordinates for d1pvxa_.
(The format of our PDB-style files is described here.)

Timeline for d1pvxa_: