SCOPe 2.05: Domain d2p4sc_: 2p4s C:

Lineage for d2p4sc_ (2p4s C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (36 species)
   not a true protein

7. Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [255539] (1 PDB entry)

8. Domain d2p4sc_: 2p4s C: [243409]
   automated match to d1tcva_
   complexed with dih, po4

Details for d2p4sc_

PDB Entry: 2p4s, 2.2 Å

PDB Description: structure of purine nucleoside phosphorylase from anopheles gambiae in complex with dadme-immh

PDB Compounds: (C:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d2p4sc_:

Sequence; same for both SEQRES and ATOM records:

>d2p4sc_ c.56.2.0 (C:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
ytydtlqeiatyllertelrpkvgiicgsglgtlaeqltdvdsfdyetiphfpvstvagh
vgrlvfgylagvpvmcmqgrfhhyegyplakcampvrvmhligcthliatnaagganpky
rvgdimlikdhinlmgfagnnplqgpnderfgprffgmantydpklnqqakviarqigie
nelregvytclggpnfetvaevkmlsmlgvdaigmstvheiitarhcgmtcfafslitnm
ctmsyeeeeehchdsivgvgknrektlgefvsrivkhihyea

Timeline for d2p4sc_:

• d2p4sc_ first appeared in SCOPe 2.04
  
• d2p4sc_ appears in SCOPe 2.06
  
• d2p4sc_ appears in the current release, SCOPe 2.08