| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
| Protein automated matches [190781] (46 species) not a true protein |
| Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [255539] (1 PDB entry) |
| Domain d2p4sb_: 2p4s B: [243408] automated match to d1tcva_ complexed with dih, po4 |
PDB Entry: 2p4s (more details), 2.2 Å
SCOPe Domain Sequences for d2p4sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4sb_ c.56.2.0 (B:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
ytydtlqeiatyllertelrpkvgiicgsglgtlaeqltdvdsfdyetiphfpvstvagh
vgrlvfgylagvpvmcmqgrfhhyegyplakcampvrvmhligcthliatnaagganpky
rvgdimlikdhinlmgfagnnplqgpnderfgprffgmantydpklnqqakviarqigie
nelregvytclggpnfetvaevkmlsmlgvdaigmstvheiitarhcgmtcfafslitnm
ctmsyeeeeehchdsivgvgknrektlgefvsrivkhihyea
Timeline for d2p4sb_: