Lineage for d2p27a_ (2p27 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149520Species Human (Homo sapiens) [TaxId:9606] [188990] (13 PDB entries)
  8. 2149525Domain d2p27a_: 2p27 A: [243406]
    automated match to d2oyca_
    complexed with mg

Details for d2p27a_

PDB Entry: 2p27 (more details), 1.9 Å

PDB Description: crystal structure of human pyridoxal phosphate phosphatase with mg2+ at 1.9 a resolution
PDB Compounds: (A:) pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d2p27a_:

Sequence, based on SEQRES records: (download)

>d2p27a_ c.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnns
rrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglrae
lraaglrlagdpsagdgaaprvravlvgydehfsfaklreacahlrdpecllvatdrdpw
hplsdgsrtpgtgslaaavetasgrqalvvgkpspymfecitenfsidpartlmvgdrle
tdilfghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegl

Sequence, based on observed residues (ATOM records): (download)

>d2p27a_ c.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnns
rrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglrae
lraaglrlagdpsaaprvravlvgydehfsfaklreacahlrdpecllvatdrdpwhpls
dgsrtpgtgslaaavetasgrqalvvgkpspymfecitenfsidpartlmvgdrletdil
fghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegl

SCOPe Domain Coordinates for d2p27a_:

Click to download the PDB-style file with coordinates for d2p27a_.
(The format of our PDB-style files is described here.)

Timeline for d2p27a_: