SCOPe 2.04: Domain d2ovya_: 2ovy A:

Lineage for d2ovya_ (2ovy A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255521] (11 PDB entries)

8. Domain d2ovya_: 2ovy A: [243401]
   automated match to d4lm1a_
   complexed with mg, pfj, so4, zn

Details for d2ovya_

PDB Entry: 2ovy, 1.8 Å

PDB Description: crystal structure of the catalytic domain of rat phosphodiesterase 10a

PDB Compounds: (A:) Phosphodiesterase-10A

SCOPe Domain Sequences for d2ovya_:

Sequence; same for both SEQRES and ATOM records:

>d2ovya_ a.211.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlparicrdielfhfdigpfenmwpgifvymihrscgtscfeleklcrfimsvkknyrrv
pyhnwkhavtvahcmyailqnnnglftdlerkglliaclchdldhrgfsnsylqkfdhpl
aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
kqleemyqtgslnlhnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
mkklgiqpipmmdrdkrdevpqgqlgfynavaipcyttltqilpptepllkacrdnlnqw
ekvir

Timeline for d2ovya_:

• d2ovya_ is new in SCOPe 2.04-stable
  
• d2ovya_ appears in SCOPe 2.05
  
• d2ovya_ appears in the current release, SCOPe 2.08