Lineage for d2ovva_ (2ovv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (9 species)
    not a true protein
  7. 2015438Species Norway rat (Rattus norvegicus) [TaxId:10116] [255521] (11 PDB entries)
  8. 2015446Domain d2ovva_: 2ovv A: [243400]
    automated match to d4lm1a_
    complexed with mg, pfh, so4, zn

Details for d2ovva_

PDB Entry: 2ovv (more details), 2 Å

PDB Description: Crystal structure of the catalytic domain of rat phosphodiesterase 10A
PDB Compounds: (A:) Phosphodiesterase-10A

SCOPe Domain Sequences for d2ovva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovva_ a.211.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lparicrdielfhfdigpfenmwpgifvymihrscgtscfeleklcrfimsvkknyrrvp
yhnwkhavtvahcmyailqnnnglftdlerkglliaclchdldhrgfsnsylqkfdhpla
alyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnrk
qleemyqtgslnlhnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegdem
kklgiqpipmmdrdkrdevpqgqlgfynavaipcyttltqilpptepllkacrdnlnqwe
kvir

SCOPe Domain Coordinates for d2ovva_:

Click to download the PDB-style file with coordinates for d2ovva_.
(The format of our PDB-style files is described here.)

Timeline for d2ovva_: