Lineage for d1bk1a_ (1bk1 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 795037Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 795082Protein Xylanase II [49979] (17 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 795083Species Aspergillus kawachii [TaxId:40384] [49988] (2 PDB entries)
    Uniprot P55328 29-210 # 100% sequence identity; Aspergillus awamori TaxID: 105351
  8. 795086Domain d1bk1a_: 1bk1 A: [24340]

Details for d1bk1a_

PDB Entry: 1bk1 (more details), 2 Å

PDB Description: endo-1,4-beta-xylanase c
PDB Compounds: (A:) endo-1,4-b-xylanase c

SCOP Domain Sequences for d1bk1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk1a_ b.29.1.11 (A:) Xylanase II {Aspergillus kawachii [TaxId: 40384]}
aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
is

SCOP Domain Coordinates for d1bk1a_:

Click to download the PDB-style file with coordinates for d1bk1a_.
(The format of our PDB-style files is described here.)

Timeline for d1bk1a_: