| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (83 species) not a true protein |
| Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries) |
| Domain d2ovld1: 2ovl D:3-129 [243398] Other proteins in same PDB: d2ovla2, d2ovlb2, d2ovlc2, d2ovld2 automated match to d3bjsa1 complexed with na |
PDB Entry: 2ovl (more details), 2.13 Å
SCOPe Domain Sequences for d2ovld1:
Sequence, based on SEQRES records: (download)
>d2ovld1 d.54.1.0 (D:3-129) automated matches {Streptomyces coelicolor [TaxId: 100226]}
liervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavat
mvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartp
lwklfgg
>d2ovld1 d.54.1.0 (D:3-129) automated matches {Streptomyces coelicolor [TaxId: 100226]}
liervrtdlyripldfelitvriedsdgatglgytytvnhggaavatmvdkdlrgcllga
daeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartplwklfgg
Timeline for d2ovld1: