Lineage for d2ovlc1 (2ovl C:4-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948596Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries)
  8. 2948603Domain d2ovlc1: 2ovl C:4-129 [243396]
    Other proteins in same PDB: d2ovla2, d2ovla3, d2ovlb2, d2ovlb3, d2ovlc2, d2ovlc3, d2ovld2, d2ovld3
    automated match to d3bjsa1
    complexed with na

Details for d2ovlc1

PDB Entry: 2ovl (more details), 2.13 Å

PDB Description: crystal structure of a racemase from streptomyces coelicolor a3(2)
PDB Compounds: (C:) Putative racemase

SCOPe Domain Sequences for d2ovlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovlc1 d.54.1.0 (C:4-129) automated matches {Streptomyces coelicolor [TaxId: 100226]}
iervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavatm
vdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartpl
wklfgg

SCOPe Domain Coordinates for d2ovlc1:

Click to download the PDB-style file with coordinates for d2ovlc1.
(The format of our PDB-style files is described here.)

Timeline for d2ovlc1: